Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C408380-20 20 µl $275 
LS-C408380-100 100 µl $389 
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded human esophagus.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded rat lung tissue.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded human esophagus.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded human stomach tissue.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded human esophagus.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded rat lung tissue.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded human esophagus.
S100A7 / Psoriasin Antibody - Immunohistochemistry of paraffin-embedded human stomach tissue.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human S100A7 / Psoriasin Antibody (IHC, WB) LS‑C408380

Polyclonal Rabbit anti‑Human S100A7 / Psoriasin Antibody (IHC, WB) LS‑C408380

Antibody:
S100A7 / Psoriasin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C408380-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
S100A7 / Psoriasin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Psoriasin antibody LS-C408380 is an unconjugated rabbit polyclonal antibody to Psoriasin (S100A7) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human S100A7 / Psoriasin
Synonyms
S100A7 | PSOR1 | Psoriasin | Protein S100-A7 | Psoriasin 1 | S100A7c
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A7 (NP_002954.2). MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Specificity
Human S100A7 / Psoriasin.
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 11kDa, while the observed MW by Western blot was Refer to Figures.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About S100A7 / Psoriasin
P31151 NM_002963 NP_002954.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/18/2024