Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
REG1A Antibody LS‑C408822
REG1A antibody LS-C408822 is an unconjugated rabbit polyclonal antibody to REG1A from human, mouse and rat. Validated for IHC and WB.
50 µl
100 µl
200 µl

Popular REG1A Products

Anti-REG1A antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4115 dilution 1:200.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, ELISA
Species: Human
Applications: ELISA
Western blot of recombinant REG1A / REG.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: IHC, ICC, Western blot, Immunoprecipitation
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Product Description

REG1A antibody LS-C408822 is an unconjugated rabbit polyclonal antibody to REG1A from human, mouse and rat. Validated for IHC and WB.
About REG1A
REG1A is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. P05451 NM_002909 NP_002900.2

REG1A Antibody, ICRF Antibody, Lithostathine 1 alpha Antibody, p19 Antibody, Pancreatic stone protein Antibody, Pancreatic thread protein Antibody, Protein-X Antibody, PSPS Antibody, REG-1-alpha Antibody, Regenerating protein I alpha Antibody, PSP Antibody, PTP Antibody, REG Antibody, Lithostathine-1-alpha Antibody, PSPS1 Antibody


Human REG1A
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
REG1A antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 50-150 of human REG1A (NP_002900.2). FNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWK
Human REG1A
The predicted MW is 18kDa, while the observed MW by Western blot was 25kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)


Western blot

Western blot blot of extracts of various cells, using REG1A antibody.
Western blot blot of extracts of various cells, using REG1A antibody.

Western blot

Western blot blot of extracts of various cells, using REG1A antibody.
Western blot blot of extracts of various cells, using REG1A antibody.

Western blot

Western blot blot of extracts of various cells, using REG1A antibody.
Western blot blot of extracts of various cells, using REG1A antibody.

Western blot

Western blot blot of extracts of various cells, using REG1A antibody.
Western blot blot of extracts of various cells, using REG1A antibody.

Requested From: United States
Date Requested: 9/21/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy