Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
RBM12 Antibody LS‑C749669
RBM12 antibody LS-C749669 is an unconjugated rabbit polyclonal antibody to human RBM12. Validated for WB.
50 µl
RBM12 antibody LS-C749669 is an unconjugated rabbit polyclonal antibody to human RBM12. Validated for WB.
Human RBM12
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
RBM12 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human RBM12 (NP_001185767.1). GGPPGFGSGPPGLGSAPGHLGGPPAFGPGPGPGPGPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG
The predicted MW is 97kDa, while the observed MW by Western blot was 110kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About RBM12
Q9NTZ6 NM_006047 CAB87611.1

Popular RBM12 Products

Detection of Human RBM12 by Immunohistochemistry. Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-RBM12 used at a dilution of 1:200 (1 ug/ml). Detection: DAB.
Species: Human, Mouse, Rat, Bovine, Dog, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
Detection of Human RBM12 by Immunohistochemistry. Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-RBM12 used at a dilution of 1:200 (1 ug/ml). Detection: DAB.
Species: Human, Mouse, Rat, Bovine, Dog, Horse, Pig
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
Species: Human, Mouse
Applications: IHC, Western blot, ELISA
RBM12 Antibody immunohistochemistry of formalin-fixed and paraffin-embedded human tonsil tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
Detection of Human RBM12 by Immunohistochemistry. Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-RBM12 used at a dilution of 1:250.
Species: Human, Mouse, Rat, Bovine, Dog, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Immunofluorescence

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.
Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.

Western blot

Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.
Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.

Western blot

Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.
Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.

Western blot

Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.
Western blot analysis of extracts of various cell lines, using RBM12 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.

Requested From: United States
Date Requested: 11/20/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy