LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

RB1CC1 / CC1 Antibody LS‑C749674

Western blot analysis of extracts of various cell lines, using RB1CC1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

RB1CC1 / CC1 Antibody LS‑C749674

Antibody:
Rabbit Polyclonal to Human RB1CC1 / CC1
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C749674-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human RB1CC1 / CC1
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
CC1 antibody LS-C749674 is an unconjugated rabbit polyclonal antibody to CC1 (RB1CC1) from human and mouse. Validated for WB.
Target
Human RB1CC1 / CC1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
RB1CC1 / CC1 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 1500 to the C-terminus of human RB1CC1 (NP_055596.3). DFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
Usage
The predicted MW is 182kDa/183kDa, while the observed MW by Western blot was 200kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About RB1CC1 / CC1
Q8TDY2 NM_014781 NP_055596.3

Publications (0)

Reviews (0)

Featured Products

Reactivity: Rat
Range: 7.8-500 pg/ml
Reactivity: Human
Range: 15.63-1000 pg/ml
Reactivity: Rat
Range: 0.156-10 ng/ml
Reactivity: Human
Range: 27.43-20000 pg/ml
Anti-GPR44 / CRTH2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA

Requested From: United States
Date Requested: 7/20/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy