Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334011-20 20 µl $263 
LS-C334011-50 50 µl $301 
LS-C334011-100 100 µl $359 
LS-C334011-200 200 µl $473 
RAD17 Antibody - Immunohistochemistry of paraffin-embedded human colon carcinoma tissue.
RAD17 Antibody - Immunofluorescence analysis of A549 cells.
RAD17 Antibody - Immunofluorescence analysis of MCF-7 cells.
RAD17 Antibody - Western blot analysis of extracts of various cell lines, using RAD17 antibody.
RAD17 Antibody - Immunoprecipitation analysis of 200ug extracts of K562 cells.
RAD17 Antibody - Immunohistochemistry of paraffin-embedded human colon carcinoma tissue.
RAD17 Antibody - Immunofluorescence analysis of A549 cells.
RAD17 Antibody - Immunofluorescence analysis of MCF-7 cells.
RAD17 Antibody - Western blot analysis of extracts of various cell lines, using RAD17 antibody.
RAD17 Antibody - Immunoprecipitation analysis of 200ug extracts of K562 cells.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human RAD17 Antibody (IHC, IF, WB) LS‑C334011

Polyclonal Rabbit anti‑Human RAD17 Antibody (IHC, IF, WB) LS‑C334011

Antibody:
RAD17 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334011-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
RAD17 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
RAD17 antibody LS-C334011 is an unconjugated rabbit polyclonal antibody to human RAD17. Validated for IF, IHC, IP and WB.
Target
Human RAD17
Synonyms
RAD17 | HRAD17 | R24L | RAD1 homolog | RAD1 (S. pombe) homolog | RAD24 | Rad17-like protein | RF-C activator 1 homolog | CCYC | RAD17 homolog (S. pombe) | RAD17SP | RF-C/activator 1 homolog
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 391-670 of human RAD17 (NP_002864.1). KILYCKRASLTELDSPRLPSHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Specificity
Human RAD17
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:10 - 1:100)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 57kDa/66kDa/75kDa/77kDa, while the observed MW by Western blot was 77kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About RAD17
O75943 NM_002873 NP_002864.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2022