Human Pyrin / MEFV / MEF

Rabbit

Human, Rat (tested or 100% immunogen sequence identity)

Polyclonal

Unconjugated

Immunogen affinity purified

Unmodified

A synthetic peptide corresponding to a sequence at the N-Terminus of human MEFV(5-39 aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by eleven amino acids.

aa5-39

Expressed in peripheral blood leukocytes, particularly in mature granulocytes and to a lesser extent in monocytes but not in lymphocytes. Detected in spleen, lung and muscle, probably as a result of leukocyte infiltration in these tissues. Not expressed in thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, liver, kidney, pancreas. Expression detected in several myeloid leukemic, colon cancer, and prostate cancer cell lines. .

• Western blot (0.1 - 0.5 µg/ml)

Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: O15553 NCBI: NM_000243 NP_000234.1