Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407952-10 10 µg $318 
LS-C407952-100 100 µg $470 
PTP4A2 / PRL-2 Antibody - PTP4A2 antibody IHC-paraffin. IHC(P): Human Prostatic Cancer Tissue.
PTP4A2 / PRL-2 Antibody - PTP4A2 antibody Western blot. All lanes: Anti PTP4A2 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Mouse Brain Tissue Lysate at 50 ug. Lane 4: Mouse Thymus Tissue Lysate at 50 ug. Lane 5: 22RV1 Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 19 kD. Observed band size: 19 kD.
PTP4A2 / PRL-2 Antibody - Flow Cytometry analysis of A431 cells using anti-PTP4A2 antibody. Overlay histogram showing A431 cells stained with anti-PTP4A2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PTP4A2 / PRL-2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-PTP4A2 antibody. Overlay histogram showing PC-3 cells stained with anti-PTP4A2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PTP4A2 / PRL-2 Antibody - Flow Cytometry analysis of U937 cells using anti-PTP4A2 antibody. Overlay histogram showing U937 cells stained with anti-PTP4A2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PTP4A2 / PRL-2 Antibody - PTP4A2 antibody IHC-paraffin. IHC(P): Human Prostatic Cancer Tissue.
PTP4A2 / PRL-2 Antibody - PTP4A2 antibody Western blot. All lanes: Anti PTP4A2 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Mouse Brain Tissue Lysate at 50 ug. Lane 4: Mouse Thymus Tissue Lysate at 50 ug. Lane 5: 22RV1 Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 19 kD. Observed band size: 19 kD.
PTP4A2 / PRL-2 Antibody - Flow Cytometry analysis of A431 cells using anti-PTP4A2 antibody. Overlay histogram showing A431 cells stained with anti-PTP4A2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PTP4A2 / PRL-2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-PTP4A2 antibody. Overlay histogram showing PC-3 cells stained with anti-PTP4A2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PTP4A2 / PRL-2 Antibody - Flow Cytometry analysis of U937 cells using anti-PTP4A2 antibody. Overlay histogram showing U937 cells stained with anti-PTP4A2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human PTP4A2 / PRL‑2 Antibody (aa40‑69, IHC, WB) LS‑C407952

Polyclonal Rabbit anti‑Human PTP4A2 / PRL‑2 Antibody (aa40‑69, IHC, WB) LS‑C407952

Antibody:
PTP4A2 / PRL-2 Rabbit anti-Human Polyclonal (aa40-69) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407952-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PTP4A2 / PRL-2 Rabbit anti-Human Polyclonal (aa40-69) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
PRL-2 antibody LS-C407952 is an unconjugated rabbit polyclonal antibody to PRL-2 (PTP4A2) (aa40-69) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human PTP4A2 / PRL-2
Synonyms
PTP4A2 | HH7-2 | HH13 | HU-PP-1 | PRL-2 | PRL2 | Ptp-IV1a | PTPCAAX2 | PTP(CAAXII) | Ptp-IV1b | OV-1 | PTP4A
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human PTP4A2 (40-69 aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
Epitope
aa40-69
Specificity
Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue. .
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PTP4A2 / PRL-2
Q12974 NM_080391 AAH70182.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 9/18/2024