Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334083-20 20 µl $263 
LS-C334083-50 50 µl $301 
LS-C334083-100 100 µl $359 
LS-C334083-200 200 µl $473 
PSRC1 / DDA3 Antibody - Immunohistochemistry of paraffin-embedded mouse stomach tissue.
PSRC1 / DDA3 Antibody - Immunohistochemistry of paraffin-embedded human esophagus tissue.
PSRC1 / DDA3 Antibody - Western blot analysis of extracts of various cell lines.
PSRC1 / DDA3 Antibody - Immunohistochemistry of paraffin-embedded mouse stomach tissue.
PSRC1 / DDA3 Antibody - Immunohistochemistry of paraffin-embedded human esophagus tissue.
PSRC1 / DDA3 Antibody - Western blot analysis of extracts of various cell lines.
1 of 3
2 of 3
3 of 3

Polyclonal Rabbit anti‑Human PSRC1 / DDA3 Antibody (IHC, WB) LS‑C334083

Polyclonal Rabbit anti‑Human PSRC1 / DDA3 Antibody (IHC, WB) LS‑C334083

Antibody:
PSRC1 / DDA3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334083-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PSRC1 / DDA3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
DDA3 antibody LS-C334083 is an unconjugated rabbit polyclonal antibody to DDA3 (PSRC1) from human. It is reactive with human and mouse. Validated for IHC and WB.
Target
Human PSRC1 / DDA3
Synonyms
PSRC1 | DDA3 | FP3214 | p53-regulated DDA3
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human PSRC1 (NP_001005290.1). MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEET
Specificity
Human PSRC1 / DDA3.
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 16kDa/33kDa/35kDa/38kDa, while the observed MW by Western blot was 39kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PSRC1 / DDA3
Q6PGN9 NM_032636 NP_116025.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/6/2022