Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > PSMA3 > LS-C662371
 
Print Page  
Catalog Number Size Price
LS-C662371-10 10 µg $318 
LS-C662371-100 100 µg $470 
PSMA3 Antibody - IHC analysis of PSMA3 using anti-PSMA3 antibody. PSMA3 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PSMA3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PSMA3 Antibody - IHC analysis of PSMA3 using anti-PSMA3 antibody. PSMA3 was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PSMA3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PSMA3 Antibody - IHC analysis of PSMA3 using anti-PSMA3 antibody. PSMA3 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PSMA3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PSMA3 Antibody - Western blot analysis of PSMA3 using anti-PSMA3 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat testis tissue lysates, Lane 2: mouse lung tissue lysates, Lane 3: 293T whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PSMA3 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PSMA3 at approximately 28KD. The expected band size for PSMA3 is at 28KD.
PSMA3 Antibody - Flow Cytometry analysis of HeLa cells using anti-PSMA3 antibody. Overlay histogram showing HeLa cells stained with anti-PSMA3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PSMA3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PSMA3 Antibody - IHC analysis of PSMA3 using anti-PSMA3 antibody. PSMA3 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PSMA3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PSMA3 Antibody - IHC analysis of PSMA3 using anti-PSMA3 antibody. PSMA3 was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PSMA3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PSMA3 Antibody - IHC analysis of PSMA3 using anti-PSMA3 antibody. PSMA3 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PSMA3 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PSMA3 Antibody - Western blot analysis of PSMA3 using anti-PSMA3 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat testis tissue lysates, Lane 2: mouse lung tissue lysates, Lane 3: 293T whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PSMA3 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PSMA3 at approximately 28KD. The expected band size for PSMA3 is at 28KD.
PSMA3 Antibody - Flow Cytometry analysis of HeLa cells using anti-PSMA3 antibody. Overlay histogram showing HeLa cells stained with anti-PSMA3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PSMA3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human PSMA3 Antibody (IHC, WB) LS‑C662371

Polyclonal Rabbit anti‑Human PSMA3 Antibody (IHC, WB) LS‑C662371

Submit Review LSBio Guarantee
Antibody:
PSMA3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662371-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
PSMA3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
PSMA3 antibody LS-C662371 is an unconjugated rabbit polyclonal antibody to human PSMA3. Validated for IHC and WB.
Target
Human PSMA3
Synonyms
PSMA3 | Proteasome component C8 | Proteasome subunit C8 | PSC8 | HC8 | Macropain subunit C8 | PSC3
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127 aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.
Applications
  • IHC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PSMA3
P25788 NM_002788 NP_002779.1

Publications (0)

Submit a Publication for LS-C662371

Customer Reviews (0)

Submit a review for LS-C662371

Featured Products

PSMA3 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC‑plus™ PSMA3 Antibody LS‑B14860
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
PSMA3 Antibody - Immunohistochemistry of paraffin-embedded human brain tissue using PSMA3 Antibody at dilution of 1:100
PSMA3 Antibody LS‑C499629
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot, ELISA
PSMA3 Antibody - Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC‑plus™ PSMA3 Antibody (aa205‑255) LS‑B13482
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
PSMA3 Antibody
PSMA3 Antibody LS‑C667982
Species: Human
Applications: ICC, Immunofluorescence, Western blot
PSMA3 Protein
Human PSMA3 Protein (Recombinant His) - LS-G1506
Source: E. coli
Tag: His
PSMA3 Protein - 12.5% SDS-PAGE of human PSMA3 stained with Coomassie Blue
Human PSMA3 Protein (Recombinant GST) (Full Length) - LS-G29969
Source: Wheat
Tag: GST
See all PSMA3 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/27/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com