Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782279-100 100 µg $575 
Properdin / CFP Antibody - IHC staining of FFPE mouse kidney with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE rat intestine with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE rat liver with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE human liver cancer with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE human cholangiocarcinoma with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE human placenta with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - Western blot testing of 1) human placenta, 2) human U937, 3) rat brain and 4) mouse brain lysate with Properdin antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.
Properdin / CFP Antibody - IHC staining of FFPE mouse kidney with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE rat intestine with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE rat liver with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE human liver cancer with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE human cholangiocarcinoma with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - IHC staining of FFPE human placenta with Properdin antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Properdin / CFP Antibody - Western blot testing of 1) human placenta, 2) human U937, 3) rat brain and 4) mouse brain lysate with Properdin antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human Properdin / CFP Antibody (IHC, WB) LS‑C782279

Polyclonal Rabbit anti‑Human Properdin / CFP Antibody (IHC, WB) LS‑C782279

Antibody:
Properdin / CFP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782279-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
Properdin / CFP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CFP antibody LS-C782279 is an unconjugated rabbit polyclonal antibody to CFP (Properdin) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human Properdin / CFP
Synonyms
CFP | Complement factor P | Complement factor properdin | PFC | PFD | Properidin | BFD | Properdin | Properdin P factor, complement
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR were used as the immunogen for the Properdin antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Optimal dilution of the Properdin antibody should be determined by the researcher.
Presentation
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About Properdin / CFP
P27918 NM_002621 NP_002612.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/24/2024