Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C781883-100 100 µg $575 
PML Antibody - IHC testing of FFPE human intestinal cancer tissue with PML antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
PML Antibody - Western blot testing of human 1) SW620 and 2) U-2 OS lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.
PML Antibody - IHC testing of FFPE human intestinal cancer tissue with PML antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
PML Antibody - Western blot testing of human 1) SW620 and 2) U-2 OS lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human PML Antibody (IHC, WB) LS‑C781883

Polyclonal Rabbit anti‑Human PML Antibody (IHC, WB) LS‑C781883

Antibody:
PML Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C781883-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PML Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
PML antibody LS-C781883 is an unconjugated rabbit polyclonal antibody to PML from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human PML
Synonyms
PML | PP8675 | Promyelocytic leukemia | Protein PML | TRIM19 | Promyelocytic leukemia protein | RING finger protein 71 | MYL | RNF71
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PML
P29590 NM_002675 NP_002666.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/23/2024