Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

PLOD / PLOD1 Antibody LS‑C409466

Catalog Number Size Price
LS-C409466-50 50 µl $255 
LS-C409466-100 100 µl $315 
LS-C409466-200 200 µl $425 
Western blot analysis of extracts of various cells.

PLOD / PLOD1 Antibody LS‑C409466

Antibody:
Rabbit Polyclonal to Human PLOD / PLOD1
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$255 
LS-C409466-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human PLOD / PLOD1
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
PLOD1 antibody LS-C409466 is an unconjugated rabbit polyclonal antibody to PLOD1 (PLOD ) from human and mouse. Validated for IHC and WB.
Target
Human PLOD / PLOD1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 488-727 of human PLOD1 (NP_000293.2). RQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTIDIHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYIAVSFVDP
Specificity
Human PLOD / PLOD1
Usage
The predicted MW is 83kDa/88kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PLOD / PLOD1
Q02809 NM_000302 NP_000293.2

Publications (0)

Reviews (0)

Featured Products

PLOD1 Antibody immunohistochemistry of formalin-fixed and paraffin-embedded human heart tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
Western blot of PLOD / PLOD1 antibody.
Species: Human
Applications: Western blot
Western blot analysis of LLH expression in SKOV3 (A); HepG2 (B); mouse brain (C); mouse liver (D) whole cell lysates.
Species: Human
Applications: Western blot
Reactivity: Human
Range: 10.97-8000 pg/ml
Reactivity: Monkey
Range: 3.125-200 pmol/ml

Requested From: United States
Date Requested: 9/21/2019