Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334645-20 20 µl $263 
LS-C334645-50 50 µl $301 
LS-C334645-100 100 µl $359 
LS-C334645-200 200 µl $473 
PHF21A / BHC80 Antibody - Western blot analysis of extracts of HeLa cell line, using PHF21A antibody.

Polyclonal Rabbit anti‑Human PHF21A / BHC80 Antibody (IHC, WB) LS‑C334645

Polyclonal Rabbit anti‑Human PHF21A / BHC80 Antibody (IHC, WB) LS‑C334645

Antibody:
PHF21A / BHC80 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334645-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PHF21A / BHC80 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
BHC80 antibody LS-C334645 is an unconjugated rabbit polyclonal antibody to BHC80 (PHF21A) from human. It is reactive with human and mouse. Validated for IHC and WB.
Target
Human PHF21A / BHC80
Synonyms
PHF21A | BM-006 | BHC80 | BRAF35/HDAC2 complex (80 kDa) | KIAA1696 | PHD finger protein 21A | BHC80a
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 461-680 of human PHF21A (NP_001095272.1). TETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK
Specificity
Human PHF21A / BHC80.
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 70kDa/74kDa, while the observed MW by Western blot was 70-80kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PHF21A / BHC80
Q96BD5 NM_016621 NP_057705.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/2/2022