Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782058-100 100 µg $575 
PAX8 Antibody - Western blot testing of human SW579 cell lysate with PAX8 antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa but also observed at 55-60 kDa.

Polyclonal Rabbit anti‑Human PAX8 Antibody (WB) LS‑C782058

Polyclonal Rabbit anti‑Human PAX8 Antibody (WB) LS‑C782058

Antibody:
PAX8 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782058-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PAX8 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
PAX8 antibody LS-C782058 is an unconjugated rabbit polyclonal antibody to human PAX8. Validated for WB.
Target
Human PAX8
Synonyms
PAX8 | Paired box 8 | Paired domain gene 8 | Paired box gene 8 | Paired box protein Pax-8
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ from the human protein were used as the immunogen for the PAX8 antibody.
Applications
  • Western blot (0.5 - 1 µg/ml)
Usage
Optimal dilution of the PAX8 antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PAX8
Q06710 NM_003466 NP_003457.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/14/2024