Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C662165-10 10 µg $318 
LS-C662165-100 100 µg $470 
PA2G4 / EBP1 Antibody - EBP1 was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody
PA2G4 / EBP1 Antibody - EBP1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody
PA2G4 / EBP1 Antibody - EBP1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody
PA2G4 / EBP1 Antibody - Western blot - Anti-EBP1 Picoband Antibody
PA2G4 / EBP1 Antibody - EBP1 was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody
PA2G4 / EBP1 Antibody - EBP1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody
PA2G4 / EBP1 Antibody - EBP1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- EBP1 Antigen Affinity purified polyclonal antibody
PA2G4 / EBP1 Antibody - Western blot - Anti-EBP1 Picoband Antibody
1 of 4
2 of 4
3 of 4
4 of 4

Polyclonal Rabbit anti‑Human PA2G4 / EBP1 Antibody (IHC, WB) LS‑C662165

Polyclonal Rabbit anti‑Human PA2G4 / EBP1 Antibody (IHC, WB) LS‑C662165

Antibody:
PA2G4 / EBP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662165-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PA2G4 / EBP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
EBP1 antibody LS-C662165 is an unconjugated rabbit polyclonal antibody to human EBP1 (PA2G4). Validated for IHC and WB.
Target
Human PA2G4 / EBP1
Synonyms
PA2G4 | ErbB-3 binding protein 1 | EBP1 | ErbB3-binding protein 1 | ErbB3-binding protein Ebp1 | p38-2G4 | HG4-1
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human EBP1 (138-178 aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.
Specificity
Isoform 2 is undetectable whereas isoform 1 is strongly expressed in cancer cells (at protein level). Isoform 1 and isoform 2 are widely expressed, including heart, brain, lung, pancreas, skeletal muscle, kidney, placenta and liver. .
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PA2G4 / EBP1
Q9UQ80 NM_006191 NP_006182.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/25/2024