Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C332340-20 20 µl $275 
LS-C332340-50 50 µl $311 
LS-C332340-100 100 µl $389 
LS-C332340-200 200 µl $503 
OX2R / Orexin Receptor 2 Antibody - Western blot analysis of extracts of mouse heart cells.
OX2R / Orexin Receptor 2 Antibody - Western blot analysis of extracts of mouse heart cell line, using HCRTR2 antibody.
OX2R / Orexin Receptor 2 Antibody - Western blot analysis of extracts of mouse heart cells.
OX2R / Orexin Receptor 2 Antibody - Western blot analysis of extracts of mouse heart cell line, using HCRTR2 antibody.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human OX2R / Orexin Receptor 2 Antibody (WB) LS‑C332340

Polyclonal Rabbit anti‑Human OX2R / Orexin Receptor 2 Antibody (WB) LS‑C332340

Antibody:
OX2R / Orexin Receptor 2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C332340-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
OX2R / Orexin Receptor 2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Orexin Receptor 2 antibody LS-C332340 is an unconjugated rabbit polyclonal antibody to Orexin Receptor 2 (OX2R) from human. It is reactive with human and mouse. Validated for WB.
Target
Human OX2R / Orexin Receptor 2
Synonyms
HCRTR2 | Hcrt receptor 2 | Hcr tr2 | Orexin receptor type 2 | Ox-2-R | OX2 receptor | OX2R | Orexin 2 receptor | Type 2 hypocretin receptor | Orexin receptor 2 | Hypocretin receptor 2 | Hypocretin receptor type 2 | Orexin type 2 receptor | OX-R2 | Ox2-R | Type 2 orexin receptor
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 380-444 of human HCRTR2 (NP_001517.2). SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW
Specificity
Human OX2R / Orexin Receptor 2
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 50kDa, while the observed MW by Western blot was 50kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About OX2R / Orexin Receptor 2
O43614 NM_001526 NP_001517.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/24/2024