Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C343298-50 50 µg $295 

Polyclonal Rabbit anti‑Fruit fly NPFR / Neuropeptide F Receptor Antibody (Preservative Free, Biotin) LS‑C343298

Polyclonal Rabbit anti‑Fruit fly NPFR / Neuropeptide F Receptor Antibody (Preservative Free, Biotin) LS‑C343298

Rabbit Polyclonal to Fruit fly NPFR / Neuropeptide F Receptor
Fruit fly
Biotin, Preservative Free
Other formats:
Catalog Number
50 µg
Toll Free North America
For Research Use Only


Rabbit Polyclonal to Fruit fly NPFR / Neuropeptide F Receptor
Fruit fly
Biotin, Preservative Free
Other formats:


Neuropeptide F Receptor antibody LS-C343298 is a biotin-conjugated rabbit polyclonal antibody to fruit fly Neuropeptide F Receptor (NPFR). Validated for ELISA.
Fruit fly NPFR / Neuropeptide F Receptor
Fruit fly (tested or 100% immunogen sequence identity)
IgG Polyclonal
Biotin. Also available Unconjugated.
Protein A + Protein G affinity chromatography
Preservative Free
  • ELISA (1:1000 - 1:5000)
  • Applications tested for the base form of this product only
Synthetic peptide derived from Drosophila Neuropeptide F. Immunogen Sequence: YNKLKSRITVVAVQASSAQRKVERGRRMKRTNC.
The rabbit anti-Drosophila Neuropeptide F antibody shows strong binding to the synthetic immunogen. Its binding activity to native protein or cross reactivity with the protein derived from other species was not tested.
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Lyophilized from PBS, No preservatives added
Sterile buffer.
Short term: Store at 4 °C for 1 month. Long term: Store at -20°C to -70°C for up to 1 year. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NPFR / Neuropeptide F Receptor

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 8/13/2020