Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C343298-50 50 µg $295 
Antibody

NPFR / Neuropeptide F Receptor Antibody (Preservative Free, Biotin) LS‑C343298

NPFR / Neuropeptide F Receptor Antibody (Preservative Free, Biotin) LS‑C343298

Antibody:
Rabbit Polyclonal to Fruit fly NPFR / Neuropeptide F Receptor
Application:
ELISA
Reactivity:
Fruit fly
Format:
Biotin, Preservative Free
Other formats:
Price
Catalog Number
$295 
LS-C343298-50
50 µg
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Fruit fly NPFR / Neuropeptide F Receptor
Application:
ELISA
Reactivity:
Fruit fly
Format:
Biotin, Preservative Free
Other formats:

Specifications

Description
Neuropeptide F Receptor antibody LS-C343298 is a biotin-conjugated rabbit polyclonal antibody to fruit fly Neuropeptide F Receptor (NPFR ). Validated for ELISA.
Target
Fruit fly NPFR / Neuropeptide F Receptor
Host
Rabbit
Reactivity
Fruit fly (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Biotin. Also available Unconjugated.
Purification
Protein A + Protein G affinity chromatography
Modifications
Preservative Free
Applications
  • ELISA (1:1000 - 1:5000)
  • Applications tested for the base form of this product only
Immunogen
Synthetic peptide derived from Drosophila Neuropeptide F. Immunogen Sequence: YNKLKSRITVVAVQASSAQRKVERGRRMKRTNC.
Specificity
The rabbit anti-Drosophila Neuropeptide F antibody shows strong binding to the synthetic immunogen. Its binding activity to native protein or cross reactivity with the protein derived from other species was not tested.
Usage
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Presentation
Lyophilized from PBS, No preservatives added
Reconstitution
Sterile buffer.
Storage
Short term: Store at 4 °C for 1 month. Long term: Store at -20°C to -70°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NPFR / Neuropeptide F Receptor
NP_524245.3

Publications (0)

Reviews (0)

Featured Products

HIF2A / EPAS1 ELISA Kit
Reactivity: Rat
Range: 78-5000 pg/ml
HVCN1 / HV1 Antibody - Anti-HVCN1 antibody IHC of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA

Requested From: United States
Date Requested: 10/20/2019