Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C408087-10 10 µg $318 
LS-C408087-100 100 µg $470 
NONO / P54NRB Antibody - nmt55/p54nrb was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
NONO / P54NRB Antibody - nmt55/p54nrb was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
NONO / P54NRB Antibody - nmt55/p54nrb was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
NONO / P54NRB Antibody - IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody nmt55/p54nrb was detected in immunocytochemical section of SKOV-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-nmt55/p54nrb Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
NONO / P54NRB Antibody - IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody nmt55/p54nrb was detected in paraffin-embedded section of human colon cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-nmt55/p54nrb Antibody overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
NONO / P54NRB Antibody - Western blot analysis of nmt55/p54nrb expression in rat brain extract (lane 1), human placenta extract (lane 2) and PANC whole cell lysates (lane 3). nmt55/p54nrb at 60 kD was detected using rabbit anti-FBXL4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
NONO / P54NRB Antibody - Flow Cytometry analysis of HeLa cells using anti-nmt55/p54nrb antibody. Overlay histogram showing HeLa cells stained with anti-nmt55/p54nrb antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-nmt55/p54nrb Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NONO / P54NRB Antibody - nmt55/p54nrb was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
NONO / P54NRB Antibody - nmt55/p54nrb was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
NONO / P54NRB Antibody - nmt55/p54nrb was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
NONO / P54NRB Antibody - IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody nmt55/p54nrb was detected in immunocytochemical section of SKOV-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-nmt55/p54nrb Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
NONO / P54NRB Antibody - IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody nmt55/p54nrb was detected in paraffin-embedded section of human colon cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-nmt55/p54nrb Antibody overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
NONO / P54NRB Antibody - Western blot analysis of nmt55/p54nrb expression in rat brain extract (lane 1), human placenta extract (lane 2) and PANC whole cell lysates (lane 3). nmt55/p54nrb at 60 kD was detected using rabbit anti-FBXL4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
NONO / P54NRB Antibody - Flow Cytometry analysis of HeLa cells using anti-nmt55/p54nrb antibody. Overlay histogram showing HeLa cells stained with anti-nmt55/p54nrb antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-nmt55/p54nrb Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human NONO / P54NRB Antibody (aa1‑35, IHC, WB) LS‑C408087

Polyclonal Rabbit anti‑Human NONO / P54NRB Antibody (aa1‑35, IHC, WB) LS‑C408087

Antibody:
NONO / P54NRB Rabbit anti-Human Polyclonal (aa1-35) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C408087-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
NONO / P54NRB Rabbit anti-Human Polyclonal (aa1-35) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
P54NRB antibody LS-C408087 is an unconjugated rabbit polyclonal antibody to P54NRB (NONO) (aa1-35) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human NONO / P54NRB
Synonyms
NONO | 55 kDa nuclear protein | NRB54 | NMT55 | NonO protein | p54 | p54(nrb) | p54NRB
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human nmt55/p54nrb (1-35 aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
Epitope
aa1-35
Specificity
Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines. .
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NONO / P54NRB
Q15233 NM_007363 NP_031389.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/25/2024