Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C781879-100 100 µg $575 
NFIA / Nuclear Factor 1 Antibody - IHC testing of FFPE rat liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
NFIA / Nuclear Factor 1 Antibody - IHC testing of FFPE mouse liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
NFIA / Nuclear Factor 1 Antibody - IHC testing of FFPE human breast cancer tissue with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
NFIA / Nuclear Factor 1 Antibody - Western blot testing of mouse 1) HEPA1-6 and 2) SP2/0 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
NFIA / Nuclear Factor 1 Antibody - Western blot testing of human 1) Jurkat and 2) COLO320 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
NFIA / Nuclear Factor 1 Antibody - IHC testing of FFPE rat liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
NFIA / Nuclear Factor 1 Antibody - IHC testing of FFPE mouse liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
NFIA / Nuclear Factor 1 Antibody - IHC testing of FFPE human breast cancer tissue with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
NFIA / Nuclear Factor 1 Antibody - Western blot testing of mouse 1) HEPA1-6 and 2) SP2/0 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
NFIA / Nuclear Factor 1 Antibody - Western blot testing of human 1) Jurkat and 2) COLO320 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human NFIA / Nuclear Factor 1 Antibody (IHC, WB) LS‑C781879

Polyclonal Rabbit anti‑Human NFIA / Nuclear Factor 1 Antibody (IHC, WB) LS‑C781879

Antibody:
NFIA / Nuclear Factor 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C781879-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
NFIA / Nuclear Factor 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Nuclear Factor 1 antibody LS-C781879 is an unconjugated rabbit polyclonal antibody to Nuclear Factor 1 (NFIA) from human. It is reactive with human, mouse and rat. Validated for Flow, IHC and WB.
Target
Human NFIA / Nuclear Factor 1
Synonyms
NFIA | CTF | NF1-A | NF-I/A | NFI-L | Nuclear Factor 1 | TGGCA-binding protein | NFI-A | Nuclear factor 1 A-type | KIAA1439 | Nuclear factor 1/A | Nuclear factor I/A
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NFIA / Nuclear Factor 1
Q12857 NM_005595 NP_005586.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/20/2024