Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C661861-10 10 µg $318 
LS-C661861-100 100 µg $470 
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of SiHa cells using anti-NFIA antibody. Overlay histogram showing SiHa cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control. Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of K562 cells using anti-NFIA antibody. Overlay histogram showing K562 cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Immunohistochemistry - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Western blot - Anti-NFIA Picoband Antibody
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of SiHa cells using anti-NFIA antibody. Overlay histogram showing SiHa cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control. Flow Cytometry analysis of U20S cells using anti-NFIA antibody. Overlay histogram showing U20S cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
NFIA / Nuclear Factor 1 Antibody - Flow Cytometry analysis of K562 cells using anti-NFIA antibody. Overlay histogram showing K562 cells stained with anti-NFIA antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

Polyclonal Rabbit anti‑Human NFIA / Nuclear Factor 1 Antibody (IHC, WB) LS‑C661861

Polyclonal Rabbit anti‑Human NFIA / Nuclear Factor 1 Antibody (IHC, WB) LS‑C661861

Antibody:
NFIA / Nuclear Factor 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C661861-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
NFIA / Nuclear Factor 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
Nuclear Factor 1 antibody LS-C661861 is an unconjugated rabbit polyclonal antibody to human Nuclear Factor 1 (NFIA). Validated for Flow, ICC, IHC and WB.
Target
Human NFIA / Nuclear Factor 1
Synonyms
NFIA | CTF | NF1-A | NF-I/A | NFI-L | Nuclear Factor 1 | TGGCA-binding protein | NFI-A | Nuclear factor 1 A-type | KIAA1439 | Nuclear factor 1/A | Nuclear factor I/A
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224 aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Applications
  • IHC
  • IHC - Paraffin
  • ICC
  • Western blot
  • Flow Cytometry
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NFIA / Nuclear Factor 1
Q12857 NM_005595 NP_005586.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/19/2024