Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407828-10 10 µg $318 
LS-C407828-100 100 µg $470 
NBN / Nibrin Antibody - IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of SMMC-7721 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-p95 NBS1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
NBN / Nibrin Antibody - IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of SW480 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-p95 NBS1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
NBN / Nibrin Antibody - p95 NBS1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
NBN / Nibrin Antibody - IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of A549 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-p95 NBS1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
NBN / Nibrin Antibody - p95 NBS1 antibody Western blot. All lanes: Anti p95 NBS1 at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Rat Liver Tissue Lysate at 50 ug. Lane 4: Mouse Testis Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: A431 Whole Cell Lysate at 40 ug. Lane 7: HUT Whole Cell Lysate at 40 ug. Predicted band size: 95 kD. Observed band size: 95 kD.
NBN / Nibrin Antibody - IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of SMMC-7721 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-p95 NBS1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
NBN / Nibrin Antibody - IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of SW480 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-p95 NBS1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
NBN / Nibrin Antibody - p95 NBS1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
NBN / Nibrin Antibody - IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of A549 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-p95 NBS1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
NBN / Nibrin Antibody - p95 NBS1 antibody Western blot. All lanes: Anti p95 NBS1 at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Rat Liver Tissue Lysate at 50 ug. Lane 4: Mouse Testis Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: A431 Whole Cell Lysate at 40 ug. Lane 7: HUT Whole Cell Lysate at 40 ug. Predicted band size: 95 kD. Observed band size: 95 kD.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human NBN / Nibrin Antibody (aa714‑745, IHC, WB) LS‑C407828

Polyclonal Rabbit anti‑Human NBN / Nibrin Antibody (aa714‑745, IHC, WB) LS‑C407828

Antibody:
NBN / Nibrin Rabbit anti-Human Polyclonal (aa714-745) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407828-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
NBN / Nibrin Rabbit anti-Human Polyclonal (aa714-745) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Nibrin antibody LS-C407828 is an unconjugated rabbit polyclonal antibody to Nibrin (NBN) (aa714-745) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human NBN / Nibrin
Synonyms
NBN | ATV | AT-V2 | Nibrin | NBS1 | AT-V1 | NBS | p95
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human p95 NBS1 (714-745 aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
Epitope
aa714-745
Specificity
Ubiquitous. Expressed at high levels in testis.
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NBN / Nibrin
O60934 NM_002485 NP_002476.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/29/2024