Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C748093-20 20 µl $275 
LS-C748093-100 100 µl $389 
MYL4 Antibody - Western blot analysis of extracts of rat heart, using MYL4 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Polyclonal Rabbit anti‑Human MYL4 Antibody (WB) LS‑C748093

Polyclonal Rabbit anti‑Human MYL4 Antibody (WB) LS‑C748093

Antibody:
MYL4 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C748093-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
MYL4 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
MYL4 antibody LS-C748093 is an unconjugated rabbit polyclonal antibody to MYL4 from human. It is reactive with human and rat. Validated for WB.
Target
Human MYL4
Synonyms
MYL4 | AMLC | Atrial, embryonic | ALC1 | Myosin light chain 4 | Myosin, light chain 4, alkali | PRO1957 | GT1
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human MYL4 (NP_002467.1). MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 21kDa, while the observed MW by Western blot was 25kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About MYL4
P12829 NM_002476 NP_002467.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024