Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > MMP13 > LS-C661972
 
Print Page  
Catalog Number Size Price
LS-C661972-10 10 µg $318 
LS-C661972-100 100 µg $470 
MMP13 Antibody - Western blot analysis of MMP13 using anti-MMP13 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human PC-3 whole cell lysates, Lane 2: human U20S whole cell lysates, Lane 3: human A549 whole cell lysates, Lane 4: human HEK293 whole cell lysates. Lane 5: Rabbit IgG(55KD), Lane 6: Marker 1113 Lane 7: human MDA-MB-453 whole cell lysates, Lane 8: monkey COS-7 whole cell lysates, Lane 9: rat lung tissue lysates, Lane 10: mouse lung tissue lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP13 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MMP13 at approximately 54KD. The expected band size for MMP13 is at 54KD.
MMP13 Antibody - Western blot analysis of MMP13 using anti-MMP13 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: HELA whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP13 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MMP13 at approximately 54KD. The expected band size for MMP13 is at 54KD.
MMP13 Antibody - Western blot analysis of MMP13 using anti-MMP13 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human PC-3 whole cell lysates, Lane 2: human U20S whole cell lysates, Lane 3: human A549 whole cell lysates, Lane 4: human HEK293 whole cell lysates. Lane 5: Rabbit IgG(55KD), Lane 6: Marker 1113 Lane 7: human MDA-MB-453 whole cell lysates, Lane 8: monkey COS-7 whole cell lysates, Lane 9: rat lung tissue lysates, Lane 10: mouse lung tissue lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP13 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MMP13 at approximately 54KD. The expected band size for MMP13 is at 54KD.
MMP13 Antibody - Western blot analysis of MMP13 using anti-MMP13 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: HELA whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP13 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MMP13 at approximately 54KD. The expected band size for MMP13 is at 54KD.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human MMP13 Antibody (WB) LS‑C661972

Polyclonal Rabbit anti‑Human MMP13 Antibody (WB) LS‑C661972

Submit Review LSBio Guarantee
Antibody:
MMP13 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C661972-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
MMP13 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
MMP13 antibody LS-C661972 is an unconjugated rabbit polyclonal antibody to human MMP13. Validated for WB.
Target
Human MMP13
Synonyms
MMP13 | Collagenase 3 | Matrix metalloproteinase-13 | Interstitial collagenase | MANDP1 | MMP-13 | CLG3
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human MMP13 (109-154 aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino aci
Specificity
Detected in fetal cartilage and calvaria, in chondrocytes of hypertrophic cartilage in vertebrae and in the dorsal end of ribs undergoing ossification, as well as in osteoblasts and periosteal cells below the inner periosteal region of ossified ribs. Detected in chondrocytes from in joint cartilage that have been treated with TNF and IL1B, but not in untreated chondrocytes. Detected in T lymphocytes. Detected in breast carcinoma tissue. .
Applications
  • Western blot
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About MMP13
P45452 NM_002427 NP_002418.1

Publications (0)

Submit a Publication for LS-C661972

Customer Reviews (0)

Submit a review for LS-C661972

Featured Products

MMP13 Antibody - Anti-MMP13 antibody IHC of human breast carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
IHC‑plus™ MMP13 Antibody (Internal) LS‑A1553
Species: Human, Monkey, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin
MMP13 Antibody - Anti-MMP13 antibody IHC of human breast carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
IHC‑plus™ MMP13 Antibody (N‑Terminus) LS‑A1552
Species: Human
Applications: IHC, IHC - Paraffin
MMP13 Antibody - Anti-MMP13 antibody IHC of human breast carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
IHC‑plus™ MMP13 Antibody (C‑Terminus) LS‑A1554
Species: Human
Applications: IHC, IHC - Paraffin
MMP13 Antibody - Anti-MMP13 antibody IHC of human breast carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
IHC‑plus™ MMP13 Antibody (C‑Terminus) LS‑A1555
Species: Human
Applications: IHC, IHC - Paraffin
Product
MMP13 Antibody (aa253‑282) LS‑C323043
Species: Human
Applications: IHC, Immunofluorescence, Western blot, ELISA
MMP13 Antibody - Immunohistochemical analysis of MMP13 staining in human breast cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
MMP13 Antibody (N‑Terminus) LS‑C352547
Species: Human, Monkey, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
See all MMP13 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 5/19/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com