LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
LIF Antibody LS‑C408299
LIF antibody LS-C408299 is an unconjugated rabbit polyclonal antibody to human LIF. Validated for IHC and WB.
Catalog
Size
Price
LS-C408299-50
50 µl
$255
LS-C408299-100
100 µl
$315
LS-C408299-200
200 µl
$425

Popular LIF Products

Antibody
Species: Human
Applications: Western blot
Fetal muscle lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse
Applications: Western blot
Anti-LIF antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7078 concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA

Product Description

LIF antibody LS-C408299 is an unconjugated rabbit polyclonal antibody to human LIF. Validated for IHC and WB.
About LIF
Leukaemia inhibitory factor is a cytokine that induces macrophage differentiation. Neurotransmitters and neuropeptides, well known for their role in the communication between neurons, are also capable of activating monocytes and macrophages and inducing chemotaxis in immune cells. LIF signals through different receptors and transcription factors. LIF in conjunction with BMP2 acts in synergy on primary fetal neural progenitor cells to induce astrocytes. P15018 NM_002309 NP_002300.1

LIF Antibody, DIA Antibody, Emfilermin Antibody, HILDA Antibody, Melanoma-derived LPL inhibitor Antibody, MLPLI Antibody, Leukemia inhibitory factor Antibody, CDF Antibody, D factor Antibody, Human interleukin in DA cells Antibody


Specifications

Target
Human LIF
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • Western blot (1:200 - 1:500)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
LIF antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 23-202 of human LIF (NP_002300.1). SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Specificity
Human LIF
Usage
The predicted MW is 9kDa/22kDa, while the observed MW by Western blot was Refer to Figures.
Presentation
PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Western blot

Western blot analysis of extracts of CEM cells.
Western blot analysis of extracts of CEM cells.

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Western blot

Western blot analysis of extracts of CEM cells.
Western blot analysis of extracts of CEM cells.

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Western blot

Western blot analysis of extracts of CEM cells.
Western blot analysis of extracts of CEM cells.

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using LIF antibody at dilution of 1:100 (40x magnification).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human prostate.
Immunohistochemistry of paraffin-embedded human prostate.

Western blot

Western blot analysis of extracts of CEM cells.
Western blot analysis of extracts of CEM cells.

Requested From: United States
Date Requested: 7/23/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number