LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
LAMP1 / CD107a Antibody IHC‑plus™ LS‑B15515
Note: This antibody replaces LS-C332188
CD107a antibody LS-B15515 is an unconjugated rabbit polyclonal antibody to CD107a (LAMP1) from human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B15515-50
50 µl
$425
Description
CD107a antibody LS-B15515 is an unconjugated rabbit polyclonal antibody to CD107a (LAMP1) from human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human LAMP1 / CD107a
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
LAMP1 / CD107a antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 80-280 of human LAMP1 (NP_005552.3). CGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS
Specificity
Human LAMP1 / CD107a.
Usage
The predicted MW is 38kDa/44kDa, while the observed MW by Western blot was 120kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About LAMP1 / CD107a
P11279 NM_005561 NP_005552.3

Popular LAMP1 / CD107a Products

Anti-LAMP1 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Anti-LAMP1 antibody IHC of mouse brain. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, Flow Cytometry
Anti-LAMP1 / CD107a antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse, Rat, Bovine, Pig
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Anti-LAMP1 / CD107a antibody IHC staining of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. This image was taken for the unmodified form of this product. Other forms have not been tested.
Species: Human, Mouse, Non-Human Primates
Applications: IHC, IHC - Paraffin, IHC - Frozen, ICC, Western blot, Flow Cytometry
Pig peripheral blood granulocytes stained with Mouse anti-Pig CD107a followed by Goat anti-Mouse IgG:FITC . Membrane permeabilization was achieved with Leucoperm.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Pig
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, Flow Cytometry

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry - Paraffin

Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.
Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.

Western blot

Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.
Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry - Paraffin

Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.
Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.

Western blot

Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.
Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry - Paraffin

Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.
Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.

Western blot

Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.
Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.

Immunohistochemistry - Paraffin

Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry - Paraffin

Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.
Immunohistochemistry of paraffin-embedded mouse kidney tissue, at a dilution of 1:100.

Western blot

Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.
Western blot analysis of extracts of various cell lines, at a dilution of 1:1000.

Requested From: United States
Date Requested: 12/14/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy