Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C335196-20 20 µl $275 
LS-C335196-100 100 µl $389 
KCNN4 / KCa3.1 Antibody - Western blot analysis of extracts of various cell lines.

Polyclonal Rabbit anti‑Human KCNN4 / KCa3.1 Antibody (WB) LS‑C335196

Polyclonal Rabbit anti‑Human KCNN4 / KCa3.1 Antibody (WB) LS‑C335196

Antibody:
KCNN4 / KCa3.1 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C335196-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
KCNN4 / KCa3.1 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
KCa3.1 antibody LS-C335196 is an unconjugated rabbit polyclonal antibody to human KCa3.1 (KCNN4). Validated for WB.
Target
Human KCNN4 / KCa3.1
Synonyms
KCNN4 | HIKCa1 | HKCa4 | HIK1 | IK1 | KCA4 | HSK4 | IKCA1 | KCa3.1 | SK4 | SKCa 4 | Putative Gardos channel | SKCa4
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 288-427 of human KCNN4 (NP_002241.1). KLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
Specificity
Human KCNN4 / KCa3.1
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 47kDa, while the observed MW by Western blot was 53kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About KCNN4 / KCa3.1
O15554 NM_002250 NP_002241.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024