Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

KCNMB1 Antibody LS-C496931

KCNMB1 antibody LS-C496931 is an unconjugated rabbit polyclonal antibody to human KCNMB1. Validated for WB.
50 µl
100 µl
200 µl
KCNMB1 antibody LS-C496931 is an unconjugated rabbit polyclonal antibody to human KCNMB1. Validated for WB.
Human KCNMB1
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:200 - 1:2000)
KCNMB1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human KCNMB1 (NP_004128.1). TYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQ
The predicted MW is 14kDa/21kDa, while the observed MW by Western blot was 18kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About KCNMB1
Q16558 NM_004137 NP_004128.1

Popular KCNMB1 Products

Immunofluorescent analysis of Maxi K+ Beta (green) in Movas cells transfected with (+) and without (-) Maxi K+ Beta siRNA. The cells were fixed with 4% paraformaldehyde for 15 minutes, permeabilized with 0.1% Triton X-100 in PBS for 10 minutes, and blocked with 3% BSA in PBS. Proteins were transferred to a nitrocellulose membrane using the G2 Fast Blotter. Proteins were transferred to a nitrocellulose membrane using the G2 Fast Blotter and blocked with 5% Milk/TBST for at least 1 hour at room temperature. Maxi K+ Beta was detected using a Maxi K+ Beta rabbit polyclonal antibody at a concentration of 1 µg/mL in blocking buffer overnight at 4°C on a rocking platform, followed by a Superclonal goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5,000 for at least 1 hour at room temperature. Chemiluminescent detection was performed using SuperSignal West Pico.
Species: Human, Chimpanzee, Mouse, Rat, Guinea pig, Hamster, Pig
Applications: Immunofluorescence, Western blot
Species: Human
Applications: Western blot, ELISA
Species: Human
Applications: Western blot, ELISA
Species: Human
Applications: Western blot, ELISA
Species: Human
Applications: Western blot, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Western blot

Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Western blot analysis of extracts of various cell lines, using KCNMB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Requested From: United States
Date Requested: 5/24/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy