LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

ITGA3 / CD49c Antibody (clone 54B3) LS‑C146758

Catalog Number Size Price
LS-C146758-0.1 0.1 mg $375 
Antibody

ITGA3 / CD49c Antibody (clone 54B3) LS‑C146758

Note: This antibody replaces LS-C147842
Antibody:
Mouse Monoclonal to Human ITGA3 / CD49c
Application:
IHC, IHC-Fr, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$375 
LS-C146758-0.1
Toll Free North America
866-819-4732

Overview

Antibody:
Mouse Monoclonal to Human ITGA3 / CD49c
Application:
IHC, IHC-Fr, ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
CD49c antibody LS-C146758 is an unconjugated mouse monoclonal antibody to human CD49c (ITGA3 ). Validated for ICC, IHC and WB.
Target
Human ITGA3 / CD49c
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Clone
54B3
Conjugations
Unconjugated
Purification
Purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Frozen (1:25 - 1:200)
  • ICC
  • Western blot (1:100 - 1:1000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Failed Applications
  • IHC - Paraffin
Immunogen
Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha-3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin
Specificity
Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3B which is present in microvascular structures in brain and heart. A broad species reactivity is expected because of the conserved nature of the epitope.
Presentation
PBS, 0.09% Sodium Azide
Storage
Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles. Store undiluted.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ITGA3 / CD49c
P26006 NM_002204 NP_002195.1

Publications (0)

Reviews (0)

Featured Products

Anti-ITGA3 / CD49c antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin
Product
Species: Human
Applications: IHC, IHC - Frozen, Immunofluorescence, Western blot, Immunoprecipitation, ELISA, Radioimmunoassay
Anti-ITGA3 / CD49c antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Bovine
Applications: IHC, IHC - Paraffin
Product
Species: Mouse
Applications: Flow Cytometry
Product
Species: Human
Applications: ICC, Immunoprecipitation, Flow Cytometry, ELISA, Radioimmunoassay
Product
Species: Human
Applications: IHC, IHC - Frozen, Flow Cytometry, Functional Assay

Requested From: United States
Date Requested: 8/22/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy