Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

INHBC Antibody (AP) LS-C505250

INHBC antibody LS-C505250 is an AP-conjugated mouse monoclonal antibody to INHBC from human and rat. Validated for ELISA, IHC and WB.
100 µl
INHBC antibody LS-C505250 is an AP-conjugated mouse monoclonal antibody to INHBC from human and rat. Validated for ELISA, IHC and WB.
Human, Rat (tested or 100% immunogen sequence identity)
IgG1 Monoclonal
Alkaline Phosphatase. Also available conjugated with Biotin, FITC, HRP, PE.
Protein G purified
  • IHC
  • Western blot
  • (applications tested for the base form of this product only)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
INHBC antibody was raised against synthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit.
Recognizes human Activin B. Species cross-reactivity: rat.
PBS, pH 7.2
Store at 4°C.
For research use only.
P55103 NM_005538 NP_005529.1

Popular INHBC Products

Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, Western blot
Species: Human, Rat
Applications: IHC, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human esophagus.
Species: Human, Mouse, Rat
Applications: IHC, Western blot
Species: Human
Applications: IHC, ICC, Immunofluorescence, Western blot, Immunoprecipitation, Flow Cytometry, ELISA, Radioimmunoassay
Immunohistochemistry of paraffin-embedded human thyroid tissue at dilution 1:100
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 4/25/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy