Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782826-100 100 µg $575 
IL-1B / IL-1 Beta Antibody - Western blot testing of 1) mouse spleen and 2) human PANC-1 lysate with IL1B antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.

Polyclonal Rabbit anti‑Human IL‑1B / IL‑1 Beta Antibody (WB) LS‑C782826

Polyclonal Rabbit anti‑Human IL‑1B / IL‑1 Beta Antibody (WB) LS‑C782826

Antibody:
IL-1B / IL-1 Beta Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782826-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
IL-1B / IL-1 Beta Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
IL-1 Beta antibody LS-C782826 is an unconjugated rabbit polyclonal antibody to IL-1 Beta (IL-1B) from human. It is reactive with human and mouse. Validated for WB.
Target
Human IL-1B / IL-1 Beta
Synonyms
IL1B | IL-1B | IL-1 beta | IL1-BETA | Preinterleukin 1 beta | Pro-interleukin-1-beta | Catabolin | IL-1 | IL1F2 | Interleukin 1, beta | Interleukin-1 beta
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE were used as the immunogen for the IL1B antibody.
Applications
  • Western blot (0.5 - 1 µg/ml)
Usage
Optimal dilution of the IL1B antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL-1B / IL-1 Beta
P01584 NM_000576 NP_000567.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/24/2024