Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IL‑1B / IL‑1 Beta Antibody LS‑C661920
IL-1 Beta antibody LS-C661920 is an unconjugated rabbit polyclonal antibody to mouse IL-1 Beta (IL-1B). Validated for WB.
100 µg

Popular IL-1B / IL-1 Beta Products

IHC of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-IL1B mouse monoclonal antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Species: Human
Applications: IHC, Immunoprecipitation, ELISA, Neutralization
Anti-Human IL-1B Antibody - Western Blot. IL-1B was used at a 1:200 dilution incubated 1 h at room temperature to detect dog IL-1B by Western blot. Lane 1 and 2 were loaded with 2.5 ug and 500 ng of dog IL-1B respectively. The molecular weight of the detected band is estimated by comparison to molecular weight markers (not shown). Detection occurred using a 1:3000 dilution of IRDye800 conjugated Donkey anti-Rabbit IgG (code # for 1h at room temperature. LICORs Odyssey Infrared Imaging System was used to scan and process the image. Other detection systems will yield similar results.
Species: Human, Dog, Primate
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, ELISA, Radioimmunoassay
Species: Sheep
Applications: Western blot, ELISA

Product Description

IL-1 Beta antibody LS-C661920 is an unconjugated rabbit polyclonal antibody to mouse IL-1 Beta (IL-1B). Validated for WB.
About IL-1B / IL-1 Beta
IL-1 Beta is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. P01584 NM_000576 NP_000567.1

IL1B Antibody, IL-1B Antibody, IL-1 beta Antibody, IL1-BETA Antibody, Preinterleukin 1 beta Antibody, Pro-interleukin-1-beta Antibody, Catabolin Antibody, IL-1 Antibody, IL1F2 Antibody, Interleukin 1, beta Antibody, Interleukin-1 beta Antibody


Mouse IL-1B / IL-1 Beta
Mouse (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • Western blot
A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE).
Expressed in activated macrophages (at protein level).
5mg BSA 0.9mg NaCl 0.2mg Na2HPO4 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)


Western blot

Western blot - Anti-IL1 beta Picoband Antibody
Western blot - Anti-IL1 beta Picoband Antibody

Western blot

Western blot - Anti-IL1 beta Picoband Antibody
Western blot - Anti-IL1 beta Picoband Antibody

Western blot

Western blot - Anti-IL1 beta Picoband Antibody
Western blot - Anti-IL1 beta Picoband Antibody

Western blot

Western blot - Anti-IL1 beta Picoband Antibody
Western blot - Anti-IL1 beta Picoband Antibody

Requested From: United States
Date Requested: 9/24/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy