Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C746953-50 50 µl $279 
IL-1B / IL-1 Beta Antibody - Immunohistochemistry of paraffin-embedded human appendix using IL1B antibody at dilution of 1:150 (40x lens).
IL-1B / IL-1 Beta Antibody - Immunohistochemistry of paraffin-embedded rat spleen using IL1B antibody at dilution of 1:150 (40x lens).
IL-1B / IL-1 Beta Antibody - Immunohistochemistry of paraffin-embedded rat lung using IL1B antibody at dilution of 1:150 (40x lens).
IL-1B / IL-1 Beta Antibody - Immunofluorescence analysis of HeLa cells using IL1B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
IL-1B / IL-1 Beta Antibody - Western blot analysis of extracts of various cell lines, using IL1B antibody at 1:1000 dilution. THP-1 cells were treated by PMA (80 nM) for overnight. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
IL-1B / IL-1 Beta Antibody - Immunohistochemistry of paraffin-embedded human appendix using IL1B antibody at dilution of 1:150 (40x lens).
IL-1B / IL-1 Beta Antibody - Immunohistochemistry of paraffin-embedded rat spleen using IL1B antibody at dilution of 1:150 (40x lens).
IL-1B / IL-1 Beta Antibody - Immunohistochemistry of paraffin-embedded rat lung using IL1B antibody at dilution of 1:150 (40x lens).
IL-1B / IL-1 Beta Antibody - Immunofluorescence analysis of HeLa cells using IL1B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
IL-1B / IL-1 Beta Antibody - Western blot analysis of extracts of various cell lines, using IL1B antibody at 1:1000 dilution. THP-1 cells were treated by PMA (80 nM) for overnight. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human IL‑1B / IL‑1 Beta Antibody (IHC, IF, WB) LS‑C746953

Polyclonal Rabbit anti‑Human IL‑1B / IL‑1 Beta Antibody (IHC, IF, WB) LS‑C746953

Antibody:
IL-1B / IL-1 Beta Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$279
LS-C746953-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
IL-1B / IL-1 Beta Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
IL-1 Beta antibody LS-C746953 is an unconjugated rabbit polyclonal antibody to IL-1 Beta (IL-1B) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human IL-1B / IL-1 Beta
Synonyms
IL1B | IL-1B | IL-1 beta | IL1-BETA | Preinterleukin 1 beta | Pro-interleukin-1-beta | Catabolin | IL-1 | IL1F2 | Interleukin 1, beta | Interleukin-1 beta
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1). CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 30kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL-1B / IL-1 Beta
P01584 NM_000576 NP_000567.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/22/2022