Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13356-50 50 µl $460 
TSAP6 / STEAP3 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSAP6 / STEAP3 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSAP6 / STEAP3 Antibody - Western blot analysis of extracts of various cell lines, using STEAP3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
TSAP6 / STEAP3 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSAP6 / STEAP3 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSAP6 / STEAP3 Antibody - Western blot analysis of extracts of various cell lines, using STEAP3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human TSAP6 / STEAP3 Antibody (IHC, WB) LS‑B13356

IHC‑plus™ Polyclonal Rabbit anti‑Human TSAP6 / STEAP3 Antibody (IHC, WB) LS‑B13356

Note: This antibody replaces LS-C331063
Antibody:
TSAP6 / STEAP3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13356-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
TSAP6 / STEAP3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
STEAP3 antibody LS-B13356 is an unconjugated rabbit polyclonal antibody to STEAP3 (TSAP6) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human TSAP6 / STEAP3
Synonyms
STEAP3 | Dudulin-2 | Dudlin 2 | Dudlin-2 | Dudulin 2 | Metalloreductase STEAP3 | HTSAP6 | PHyde | Tumor suppressor pHyde | TSAP6 | HpHyde | STMP3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STEAP3 (NP_060704.2). MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
Specificity
Human TSAP6 / STEAP3
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 50kDa/54kDa/55kDa, while the observed MW by Western blot was 55kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TSAP6 / STEAP3
Q658P3 NM_018234 NP_060704.2

Validation

TSAP6 / STEAP3 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

TSAP6 / STEAP3 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ TSAP6 / STEAP3 Antibody for IHC, WB/Western LS-B13356 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/26/2021