Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13357-50 50 µl $460 
NBN / Nibrin Antibody - Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
NBN / Nibrin Antibody - Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
NBN / Nibrin Antibody - Western blot analysis of extracts of various cell lines, using NBN antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
NBN / Nibrin Antibody - Western blot analysis of extracts of various cell lines, using NBN antibody.
NBN / Nibrin Antibody - Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
NBN / Nibrin Antibody - Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
NBN / Nibrin Antibody - Western blot analysis of extracts of various cell lines, using NBN antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
NBN / Nibrin Antibody - Western blot analysis of extracts of various cell lines, using NBN antibody.
1 of 4
2 of 4
3 of 4
4 of 4

IHC‑plus™ Polyclonal Rabbit anti‑Human NBN / Nibrin Antibody (IHC, WB) LS‑B13357

IHC‑plus™ Polyclonal Rabbit anti‑Human NBN / Nibrin Antibody (IHC, WB) LS‑B13357

Note: This antibody replaces LS-C331112
Antibody:
NBN / Nibrin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13357-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
NBN / Nibrin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
Nibrin antibody LS-B13357 is an unconjugated rabbit polyclonal antibody to Nibrin (NBN) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human NBN / Nibrin
Synonyms
NBN | ATV | AT-V2 | Nibrin | NBS1 | AT-V1 | NBS | p95
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 435-754 of human NBN (NP_002476.2). KLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Specificity
Human NBN / NBS1 / Nibrin
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:1000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 84kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NBN / Nibrin
O60934 NM_002485 NP_002476.2

Validation

NBN / Nibrin Antibody - Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)

NBN / Nibrin Antibody - Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ NBN / Nibrin Antibody for IHC, WB/Western LS-B13357 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/8/2021