Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13367-50 50 µl $460 
MAD2L1 / MAD2 Antibody - Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
MAD2L1 / MAD2 Antibody - Immunofluorescence analysis of U2OS cells using MAD2L1 antibody. Blue: DAPI for nuclear staining.
MAD2L1 / MAD2 Antibody - Western blot analysis of extracts of various cell lines, using MAD2L1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
MAD2L1 / MAD2 Antibody - Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
MAD2L1 / MAD2 Antibody - Immunofluorescence analysis of U2OS cells using MAD2L1 antibody. Blue: DAPI for nuclear staining.
MAD2L1 / MAD2 Antibody - Western blot analysis of extracts of various cell lines, using MAD2L1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human MAD2L1 / MAD2 Antibody (IHC, IF, WB) LS‑B13367

IHC‑plus™ Polyclonal Rabbit anti‑Human MAD2L1 / MAD2 Antibody (IHC, IF, WB) LS‑B13367

Note: This antibody replaces LS-C331643
Antibody:
MAD2L1 / MAD2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13367-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
MAD2L1 / MAD2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
MAD2 antibody LS-B13367 is an unconjugated rabbit polyclonal antibody to MAD2 (MAD2L1) from human. It is reactive with human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human MAD2L1 / MAD2
Synonyms
MAD2L1 | HSMAD2 | MAD2 | MAD2-like protein 1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human MAD2L1 (NP_002349.1). MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Specificity
Human MAD2L1 / MAD2
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 10kDa/23kDa, while the observed MW by Western blot was 25kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About MAD2L1 / MAD2
Q13257 NM_002358 NP_002349.1

Validation

MAD2L1 / MAD2 Antibody - Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ MAD2L1 / MAD2 Antibody for IHC, IF/Immunofluorescence, WB/Western LS-B13367 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2021