Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B14528-50 50 µl (1.09 mg/ml) $460 
IL1RN Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
IL1RN Antibody - Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.
IL1RN Antibody - Western blot analysis of extracts of various cell lines, using IL1RN antibody.
IL1RN Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
IL1RN Antibody - Immunofluorescence analysis of MCF7 cell using IL1RN antibody. Blue: DAPI for nuclear staining.
IL1RN Antibody - Western blot analysis of extracts of various cell lines, using IL1RN antibody.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human IL1RN Antibody (IHC, IF, WB) LS‑B14528

IHC‑plus™ Polyclonal Rabbit anti‑Human IL1RN Antibody (IHC, IF, WB) LS‑B14528

Note: This antibody replaces LS-C335202
Antibody:
IL1RN Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B14528-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
IL1RN Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, IF, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
IL1RN antibody LS-B14528 is an unconjugated rabbit polyclonal antibody to IL1RN from human. It is reactive with human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human IL1RN
Synonyms
IL1RN | DIRA | IL-1ra | IL-1RN | IL1F3 | IL1RA | MVCD4 | IL1 inhibitor | IL1RN (IL1F3) | IRAP | ICIL-1RA | IL-1ra3
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-159 of human IL1RN (NP_000568.1). MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Specificity
Human IL1RN
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 16kDa/17kDa/19kDa/20kDa, while the observed MW by Western blot was 23kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IL1RN
P18510 NM_000577 NP_000568.1

Validation

IL1RN Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ IL1RN Antibody for IHC, IF/Immunofluorescence, WB/Western LS-B14528 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/28/2024