Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B15532-50 50 µl (0.49 mg/ml) $460 
FCGRT / FCRN Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
FCGRT / FCRN Antibody - Western blot analysis of extracts of various cells.
FCGRT / FCRN Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
FCGRT / FCRN Antibody - Western blot analysis of extracts of various cells.
1 of 2
2 of 2

IHC‑plus™ Polyclonal Rabbit anti‑Human FCGRT / FCRN Antibody (IHC, WB) LS‑B15532

IHC‑plus™ Polyclonal Rabbit anti‑Human FCGRT / FCRN Antibody (IHC, WB) LS‑B15532

Note: This antibody replaces LS-C410079
Antibody:
FCGRT / FCRN Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B15532-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
FCGRT / FCRN Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
FCRN antibody LS-B15532 is an unconjugated rabbit polyclonal antibody to FCRN (FCGRT) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human FCGRT / FCRN
Synonyms
FCGRT | FCRN | FcRn alpha chain | Neonatal Fc-receptor for Ig | Neonatal Fc receptor | Alpha-chain
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 27-290 of human FcRn (NP_004098.1). HLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
Specificity
Human FCGRT / FCRN
Applications
  • IHC
  • IHC - Paraffin (1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 39kDa, while the observed MW by Western blot was 55kDa.
Presentation
PBS with 0.05% proclin300, 50% glycerol, pH7.3
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About FCGRT / FCRN
P55899 NM_004107 NP_004098.1

Validation

FCGRT / FCRN Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ FCGRT / FCRN Antibody for IHC, WB/Western LS-B15532 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024