Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

IBSP / Bone Sialoprotein Antibody LS-C662185

Bone Sialoprotein antibody LS-C662185 is an unconjugated rabbit polyclonal antibody to human Bone Sialoprotein (IBSP). Validated for WB.
100 µg
Bone Sialoprotein antibody LS-C662185 is an unconjugated rabbit polyclonal antibody to human Bone Sialoprotein (IBSP). Validated for WB.
Human IBSP / Bone Sialoprotein
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • Western blot
A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ).
5mg BSA 0.9mg NaCl 0.2mg Na2HPO4 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About IBSP / Bone Sialoprotein
P21815 NM_004967 NP_004958.2

Popular IBSP / Bone Sialoprotein Products

Species: Human
Applications: IHC, IHC - Paraffin, ICC, Western blot, ELISA
Species: Human, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA, Radioimmunoassay
IBSP / Bone Sialoprotein antibody. IHC(P): Human Osteosarcoma Tissue.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
Species: Human
Applications: Western blot, ELISA
Species: Human, Mouse, Rat
Applications: Western blot, Immunoprecipitation

Publications (0)

Customer Reviews (0)


Western blot

Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody
Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody

Western blot

Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody
Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody

Western blot

Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody
Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody

Western blot

Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody
Western blot - Anti-IBSP/Bone Sialoprotein Picoband Antibody

Requested From: United States
Date Requested: 4/23/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy