LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

HSD2 / HSD11B2 Antibody LS-C490611

1 of 4
2 of 4
3 of 4
4 of 4

HSD2 / HSD11B2 Antibody LS-C490611

Antibody:
Rabbit Polyclonal to Human HSD2 / HSD11B2
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$435 
LS-C490611-100
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human HSD2 / HSD11B2
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
HSD11B2 antibody LS-C490611 is an unconjugated rabbit polyclonal antibody to HSD11B2 (HSD2) from human, mouse and rat. Validated for IHC and WB.

Target
Human HSD2 / HSD11B2
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
HSD2 / HSD11B2 antibody was raised against amino acids EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH of human HSD11B2 were used as the immunogen for the HSD11B2 antibody.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Sterile distilled water
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HSD2 / HSD11B2
P80365 NM_000196 NP_000187.3

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 1-200 ng/ml
Reactivity: Human
Range: 31.2-2000 pg/ml
Reactivity: Human
Range: 12.35-1000 pg/ml
Reactivity: Human
Range: 1.56-100 ng/ml

Requested From: United States
Date Requested: 5/26/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy