LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

HMOX1 / HO-1 Antibody (aa1-30) LS-C15741

HO-1 antibody LS-C15741 is an unconjugated rabbit polyclonal antibody to HO-1 (HMOX1) from human and bat. Validated for IP and WB.
Catalog
Size
Price
LS-C15741-50
50 µg
$425
LS-C15741-200
200 µg
$680
Description
HO-1 antibody LS-C15741 is an unconjugated rabbit polyclonal antibody to HO-1 (HMOX1) from human and bat. Validated for IP and WB.
Target
Human HMOX1 / HO-1
Host
Rabbit
Reactivity
Human, Bat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antiserum
Modifications
Unmodified
Applications
  • Western blot (1:2500)
  • Immunoprecipitation (1:100)
Immunogen
HMOX1 / HO-1 antibody was raised against synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to aa1-30 of human HO-1 prepared as a four branched multiple antigen peptide. Percent identity by BLAST analysis: Human, Orangutan, Gibbon, Marmoset, Bat (100%); Monkey, Mouse (97%); Elephant (90%); Rat, Pig (87%).
Epitope
aa1-30
Specificity
Identifies purified rat HO-1 protein and will detect an ~32kD protein, corresponding to the apparent molecular mass of heme-oxygenase-1 on SDS-PAGE immunoblot. Species cross-reactivity: human, mouse, rat, canine, monkey, rabbit and hamster. Does not detect heme-oxygenase-2.
Usage
Suitable for use in Western Blot and Immunoprecipitation. Western Blot (ECL): 1:1000. Immunoprecipitation: 1:100.
Presentation
PBS, 0.09% Sodium Azide, 50% Glycerol
Storage
Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About HMOX1 / HO-1
P09601 NM_002133 NP_002124.1

Popular HMOX1 / HO-1 Products

Anti-HMOX1 / Heme Oxygenase 1 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human, Monkey, Mouse, Rat, Dog, Hamster, Rabbit
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation
Antibody
Species: Rat, Human, Monkey, Mouse, Dog, Guinea pig, Hamster, Pig
Applications: Flow Cytometry
Anti-HMOX1 / Heme Oxygenase 1 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Rat, Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
Anti-HMOX1 / Heme Oxygenase 1 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human, Mouse, Rat, Bovine, Dog
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
HO-1 (1F12-A6), Recombinant HO-1.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Bovine
Applications: IHC, ICC, Western blot, Immunoprecipitation, ELISA

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 4/21/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy