LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

HMOX1 / HO-1 Antibody (aa1-30) LS-C15741

Antibody

HMOX1 / HO-1 Antibody (aa1-30) LS-C15741

Antibody:
Rabbit Polyclonal to Human HMOX1 / HO-1
Application:
WB, IP
Reactivity:
Human, Bat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-C15741-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human HMOX1 / HO-1
Application:
WB, IP
Reactivity:
Human, Bat
Format:
Unconjugated, Unmodified

Specifications

Description
HO-1 antibody LS-C15741 is an unconjugated rabbit polyclonal antibody to HO-1 (HMOX1) from human and bat. Validated for IP and WB.

Target
Human HMOX1 / HO-1
Host
Rabbit
Reactivity
Human, Bat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antiserum
Modifications
Unmodified
Applications
  • Western blot (1:2500)
  • Immunoprecipitation (1:100)
Immunogen
HMOX1 / HO-1 antibody was raised against synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to aa1-30 of human HO-1 prepared as a four branched multiple antigen peptide. Percent identity by BLAST analysis: Human, Orangutan, Gibbon, Marmoset, Bat (100%); Monkey, Mouse (97%); Elephant (90%); Rat, Pig (87%).
Epitope
aa1-30
Specificity
Identifies purified rat HO-1 protein and will detect an ~32kD protein, corresponding to the apparent molecular mass of heme-oxygenase-1 on SDS-PAGE immunoblot. Species cross-reactivity: human, mouse, rat, canine, monkey, rabbit and hamster. Does not detect heme-oxygenase-2.
Usage
Suitable for use in Western Blot and Immunoprecipitation. Western Blot (ECL): 1:1000. Immunoprecipitation: 1:100.
Presentation
PBS, 0.09% Sodium Azide, 50% Glycerol
Storage
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HMOX1 / HO-1
P09601 NM_002133 NP_002124.1

Publications (0)

Reviews (0)

Featured Products

Reactivity: Cynomolgus
Range: 0.7-10 ng/ml
Reactivity: Human
Range: 78-5000 pg/ml
Reactivity: Human
Range: 0.156-10 ng/ml
Reactivity: Human
Range: 78-5000 pg/ml
Product
Species: Human
Applications: Western blot, ELISA

Requested From: United States
Date Requested: 7/15/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy