Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C782761-100 100 µg $435 
HBV / Hepatitis B Virus Antibody - IHC testing of FFPE human Hepatitis B+ tissue with Hepatitis B Virus antibody at 0.5ug/ml. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
HBV / Hepatitis B Virus Antibody - IHC testing of FFPE human liver cancer tissue with Hepatitis B Virus antibody at 0.5ug/ml. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
HBV / Hepatitis B Virus Antibody - IHC testing of FFPE human Hepatitis B+ tissue with Hepatitis B Virus antibody at 0.5ug/ml. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
HBV / Hepatitis B Virus Antibody - IHC testing of FFPE human liver cancer tissue with Hepatitis B Virus antibody at 0.5ug/ml. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
1 of 2
2 of 2

HBV / Hepatitis B Virus Antibody LS‑C782761

HBV / Hepatitis B Virus Antibody LS‑C782761

Rabbit Polyclonal to Hepatitis B Virus HBV / Hepatitis B Virus
Hepatitis B Virus
Unconjugated, Unmodified
Catalog Number
100 µg
Toll Free North America


Rabbit Polyclonal to Hepatitis B Virus HBV / Hepatitis B Virus
Hepatitis B Virus
Unconjugated, Unmodified


Hepatitis B Virus antibody LS-C782761 is an unconjugated rabbit polyclonal antibody to hepatitis b virus Hepatitis B Virus (HBV ). Validated for IHC and WB.
HBV / Hepatitis B Virus
Hepatitis B Virus (tested or 100% immunogen sequence identity)
IgG Polyclonal
Antigen Affinity purification
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.
Optimal dilution of the Hepatitis B Virus antibody should be determined by the researcher.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitute with 0.2ml distilled water
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee

Publications (0)

Reviews (0)

Featured Products

Species: Hepatitis B Virus
Applications: Western blot, ELISA
Species: Hepatitis B Virus
Applications: Western blot, ELISA
Species: Hepatitis B Virus, Virus
Applications: ELISA
Species: Hepatitis B Virus, Virus
Applications: ELISA
Species: Hepatitis B Virus, Virus
Applications: ELISA
Species: Human
Applications: Western blot, ELISA

Requested From: United States
Date Requested: 10/16/2019