LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
GMPR1 / GMPR Antibody LS‑C747429
GMPR antibody LS-C747429 is an unconjugated rabbit polyclonal antibody to GMPR (GMPR1) from human, mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C747429-50
50 µl
$235
Description
GMPR antibody LS-C747429 is an unconjugated rabbit polyclonal antibody to GMPR (GMPR1) from human, mouse and rat. Validated for IHC and WB.
Target
Human GMPR1 / GMPR
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
GMPR1 / GMPR antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human GMPR (NP_006868.3). TFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
Usage
The predicted MW is 37kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About GMPR1 / GMPR
P36959 NM_006877 NP_006868.3

Popular GMPR1 / GMPR Products

Antibody
Species: Human
Applications: IHC, Western blot, ELISA
GMPR Antibody immunohistochemistry of formalin-fixed and paraffin-embedded human breast carcinoma followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human
Applications: Western blot, ELISA
Antibody
Species: Human
Applications: Western blot, ELISA

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human placenta using GMPR antibody at dilution of 1:100 (40x lens).

Western blot

Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using GMPR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Requested From: United States
Date Requested: 11/20/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy