Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331670-20 20 µl $275 
LS-C331670-100 100 µl $389 
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded rat heart using FXN antibodyat dilution of 1:100 (40x lens).
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded mouse heart using FXN antibodyat dilution of 1:100 (40x lens).
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded human liver cancer using FXN antibody at dilution of 1:100 (200x lens).
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded rat kidney using FXN antibody at dilution of 1:100 (200x lens).
FXN / Frataxin Antibody - Immunofluorescence analysis of A549 cells using FXN antibody. Blue: DAPI for nuclear staining.
FXN / Frataxin Antibody - Immunofluorescence analysis of MCF7 cell using FXN antibody. Blue: DAPI for nuclear staining.
FXN / Frataxin Antibody - Western blot analysis of extracts of various cell lines, using FXN antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded rat heart using FXN antibodyat dilution of 1:100 (40x lens).
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded mouse heart using FXN antibodyat dilution of 1:100 (40x lens).
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded human liver cancer using FXN antibody at dilution of 1:100 (200x lens).
FXN / Frataxin Antibody - Immunohistochemistry of paraffin-embedded rat kidney using FXN antibody at dilution of 1:100 (200x lens).
FXN / Frataxin Antibody - Immunofluorescence analysis of A549 cells using FXN antibody. Blue: DAPI for nuclear staining.
FXN / Frataxin Antibody - Immunofluorescence analysis of MCF7 cell using FXN antibody. Blue: DAPI for nuclear staining.
FXN / Frataxin Antibody - Western blot analysis of extracts of various cell lines, using FXN antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human FXN / Frataxin Antibody (IHC, IF, WB) LS‑C331670

Polyclonal Rabbit anti‑Human FXN / Frataxin Antibody (IHC, IF, WB) LS‑C331670

Antibody:
FXN / Frataxin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C331670-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
FXN / Frataxin Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Frataxin antibody LS-C331670 is an unconjugated rabbit polyclonal antibody to Frataxin (FXN) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human FXN / Frataxin
Synonyms
FXN | CyaY | Frataxin, mitochondrial | Friedreich ataxia protein | FARR | Friedreich ataxia | FA | FRDA | X25 | Frataxin
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 42-210 of human FXN (NP_000135.2). LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Specificity
Human FXN / Frataxin
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 19kDa/21kDa/23kDa, while the observed MW by Western blot was 14kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About FXN / Frataxin
Q16595 NM_000144 NP_000135.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024