Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
FUT2 / SE Antibody LS‑C408870
SE antibody LS-C408870 is an unconjugated rabbit polyclonal antibody to human SE (FUT2). Validated for IHC and WB.
50 µl
100 µl
200 µl

Popular FUT2 / SE Products

Species: Human
Applications: Western blot, ELISA
Western Blot analysis of FUT2 expression in transfected 293T cell line by FUT2 monoclonal antibody (M02), clone 4C12.Lane 1: FUT2 transfected lysate(17.5 KDa).Lane 2: Non-transfected lysate.
Species: Human, Mouse
Applications: Western blot, ELISA
Human, Placenta: Formalin-Fixed Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Species: Human
Applications: IHC, ELISA

Product Description

SE antibody LS-C408870 is an unconjugated rabbit polyclonal antibody to human SE (FUT2). Validated for IHC and WB.


Human FUT2 / SE
FUT2, Alpha (1,2) fucosyltransferase, Alpha(1,2)FT2, Alpha(1,2)FT 2, SEC2, Se2, Secretor factor, Sej, B12QTL1, Fucosyltransferase 2, SE
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
FUT2 / SE antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 29-150 of human FUT2 (NP_001091107.1). QQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGY
Human FUT2 / SE
The predicted MW is 37kDa/39kDa, while the observed MW by Western blot was 39kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About FUT2 / SE
Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. Q10981 NM_000511 NP_000502.4

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 11/15/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy