Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C748537-20 20 µl $275 
LS-C748537-50 50 µl $311 
LS-C748537-100 100 µl (1.01 mg/ml) $389 
LS-C748537-200 200 µl $503 
ELF3 / ESE1 Antibody - Immunohistochemistry of paraffin-embedded mouse heart using ELF3 antibody at dilution of 1:100 (40x lens).
ELF3 / ESE1 Antibody - Immunofluorescence analysis of MCF7 cells using ELF3 antibody. Blue: DAPI for nuclear staining.
ELF3 / ESE1 Antibody - Western blot analysis of extracts of various cell lines, using ELF3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
ELF3 / ESE1 Antibody - Immunoprecipitation analysis of 150ug extracts of A549 cells using 3ug ELF3 antibody. Western blot was performed from the immunoprecipitate using ELF3 antibody at a dilition of 1:500.
ELF3 / ESE1 Antibody - Immunohistochemistry of paraffin-embedded mouse heart using ELF3 antibody at dilution of 1:100 (40x lens).
ELF3 / ESE1 Antibody - Immunofluorescence analysis of MCF7 cells using ELF3 antibody. Blue: DAPI for nuclear staining.
ELF3 / ESE1 Antibody - Western blot analysis of extracts of various cell lines, using ELF3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
ELF3 / ESE1 Antibody - Immunoprecipitation analysis of 150ug extracts of A549 cells using 3ug ELF3 antibody. Western blot was performed from the immunoprecipitate using ELF3 antibody at a dilition of 1:500.
1 of 4
2 of 4
3 of 4
4 of 4

Polyclonal Rabbit anti‑Human ELF3 / ESE1 Antibody (IHC, IF, WB) LS‑C748537

Polyclonal Rabbit anti‑Human ELF3 / ESE1 Antibody (IHC, IF, WB) LS‑C748537

Antibody:
ELF3 / ESE1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C748537-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ELF3 / ESE1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
ESE1 antibody LS-C748537 is an unconjugated rabbit polyclonal antibody to ESE1 (ELF3) from human. It is reactive with human and mouse. Validated for IF, IHC, IP and WB.
Target
Human ELF3 / ESE1
Synonyms
ELF3 | ERT | ESE-1 | ESE1 | JEN | ESX | E74-like factor 3 | EPR-1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ELF3 (NP_004424.3). MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:20 - 1:50)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 39kDa/41kDa, while the observed MW by Western blot was 41kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ELF3 / ESE1
P78545 NM_004433 NP_004424.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/27/2024