Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C662946-10 10 µg $318 
LS-C662946-100 100 µg $470 
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody. FABP5 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-FABP5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody - Western blot analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody. FABP5 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-FABP5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody - IHC analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody - Western blot analysis of FABP5 using anti-FABP5 antibody
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human E‑FABP / FABP5 Antibody (IHC, WB) LS‑C662946

Polyclonal Rabbit anti‑Human E‑FABP / FABP5 Antibody (IHC, WB) LS‑C662946

Antibody:
E-FABP / FABP5 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662946-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
E-FABP / FABP5 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
FABP5 antibody LS-C662946 is an unconjugated rabbit polyclonal antibody to human FABP5 (E-FABP). Validated for IHC and WB.
Target
Human E-FABP / FABP5
Synonyms
FABP5 | KFABP | Fatty acid-binding protein 5 | PA-FABP | E-FABP | EFABP | PAFABP
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
Specificity
Keratinocytes; highly expressed in psoriatic skin.
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About E-FABP / FABP5
Q01469 NM_001444 NP_001435.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/15/2024