Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
CYP2J2 Antibody LS‑C408878
CYP2J2 antibody LS-C408878 is an unconjugated rabbit polyclonal antibody to CYP2J2 from mouse and rat. Validated for IHC and WB.
50 µl
100 µl
200 µl

Popular CYP2J2 Products

Immunohistochemical analysis of Cytochrome P450 2J2 staining in human liver cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot, Immunoprecipitation
Western blot of HT29 cell lysate using Cytochrome P450 2J2 Antibody
Species: Human
Applications: IHC, ICC, Immunofluorescence, Western blot
Immunohistochemistry analysis of paraffin-embedded human heart tissue, using Cytochrome P450 2J2 Antibody. The picture on the right is blocked with the synthesized peptide.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Western blot of CYP2J2 antibody
Species: Human, Monkey
Applications: IHC, Immunofluorescence, Western blot, ELISA
Formalin-fixed and paraffin-embedded human hepatocarcinoma reacted with CYP2J2 Antibody , which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry

Product Description

CYP2J2 antibody LS-C408878 is an unconjugated rabbit polyclonal antibody to CYP2J2 from mouse and rat. Validated for IHC and WB.
About CYP2J2
This enzyme metabolizes arachidonic acid predominantly via a NADPH-dependent olefin epoxidation to all four regioisomeric cis-epoxyeicosatrienoic acids. One of the predominant enzymes responsible for the epoxidation of endogenous cardiac arachidonic acid pools. P51589 NM_000775 NP_000766.2

CYP2J2 Antibody, Arachidonic acid epoxygenase Antibody, CYPIIJ2 Antibody, Cytochrome p450 IIj2 Antibody, CPJ2 Antibody, Cytochrome P450 2J2 Antibody


Human CYP2J2
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
CYP2J2 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CYP2J2 (NP_000766.2). RFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
Human CYP2J2
The predicted MW is 57kDa, while the observed MW by Western blot was 60kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 8/20/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy