Research Areas
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us


Orders Processing,
Shipping & Receiving,

2 Shaker Rd Suites
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us

Additional Contact Details

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C334039-20 20 µl $275 
LS-C334039-50 50 µl $311 
LS-C334039-100 100 µl $389 
LS-C334039-200 200 µl $503 
CYB5A / Cytochrome b5 Antibody - Immunohistochemistry of paraffin-embedded human colon tissue.
CYB5A / Cytochrome b5 Antibody - Western blot analysis of extracts of various cell lines.
CYB5A / Cytochrome b5 Antibody - Immunohistochemistry of paraffin-embedded human colon tissue.
CYB5A / Cytochrome b5 Antibody - Western blot analysis of extracts of various cell lines.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human CYB5A / Cytochrome b5 Antibody (IHC, WB) LS‑C334039

Polyclonal Rabbit anti‑Human CYB5A / Cytochrome b5 Antibody (IHC, WB) LS‑C334039

CYB5A / Cytochrome b5 Rabbit anti-Human Polyclonal Antibody
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


CYB5A / Cytochrome b5 Rabbit anti-Human Polyclonal Antibody
Unconjugated, Unmodified


Cytochrome b5 antibody LS-C334039 is an unconjugated rabbit polyclonal antibody to human Cytochrome b5 (CYB5A). Validated for IHC and WB.
Human CYB5A / Cytochrome b5
CYB5A | CYB5 | Cytochrome b5 (microsomal) | MCB5 | Type 1 cyt-b5 | Cytochrome b-5 | Cytochrome b5
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1). MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI
Human CYB5A / Cytochrome b5
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 11kDa/14kDa/15kDa, while the observed MW by Western blot was 17kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CYB5A / Cytochrome b5
P00167 NM_001914 NP_001905.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 4/19/2024