Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
CYB5A / Cytochrome b5 Antibody LS‑C334039
Cytochrome b5 antibody LS-C334039 is an unconjugated rabbit polyclonal antibody to human Cytochrome b5 (CYB5A). Validated for IHC and WB.
50 µl
100 µl
200 µl
Cytochrome b5 antibody LS-C334039 is an unconjugated rabbit polyclonal antibody to human Cytochrome b5 (CYB5A). Validated for IHC and WB.
Human CYB5A / Cytochrome b5
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1). MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI
Human CYB5A / Cytochrome b5
The predicted MW is 11kDa/14kDa/15kDa, while the observed MW by Western blot was 17kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CYB5A / Cytochrome b5
P00167 NM_001914 NP_001905.1

Popular CYB5A / Cytochrome b5 Products

Anti-CYB5A / Cytochrome b5 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation, ELISA
Anti-CYB5A / Cytochrome b5 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Species: Rabbit, Human, Rat
Applications: Western blot, ELISA
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Publications (0)

Customer Reviews (0)



Immunohistochemistry of paraffin-embedded human colon tissue.
Immunohistochemistry of paraffin-embedded human colon tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.


Immunohistochemistry of paraffin-embedded human colon tissue.
Immunohistochemistry of paraffin-embedded human colon tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.


Immunohistochemistry of paraffin-embedded human colon tissue.
Immunohistochemistry of paraffin-embedded human colon tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.


Immunohistochemistry of paraffin-embedded human colon tissue.
Immunohistochemistry of paraffin-embedded human colon tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 12/19/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy