Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C331365-20 20 µl $263 
LS-C331365-50 50 µl $301 
LS-C331365-100 100 µl $359 
LS-C331365-200 200 µl $473 
CST8 / CRES Antibody - Immunofluorescence analysis of HeLa cells using CST8 antibody. Blue: DAPI for nuclear staining.
CST8 / CRES Antibody - Western blot analysis of extracts of various cell lines, using CST8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
CST8 / CRES Antibody - Immunofluorescence analysis of HeLa cells using CST8 antibody. Blue: DAPI for nuclear staining.
CST8 / CRES Antibody - Western blot analysis of extracts of various cell lines, using CST8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human CST8 / CRES Antibody (IHC, IF, WB) LS‑C331365

Polyclonal Rabbit anti‑Human CST8 / CRES Antibody (IHC, IF, WB) LS‑C331365

CST8 / CRES Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


CST8 / CRES Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified


CRES antibody LS-C331365 is an unconjugated rabbit polyclonal antibody to CRES (CST8) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
Human CST8 / CRES
CST8 | CRES | Cystatin-8 | CTES5
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1). MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
Human CST8 / CRES
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 16kDa, while the observed MW by Western blot was 27kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CST8 / CRES
O60676 NM_005492 NP_005483.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 11/27/2022