Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
CLCN2 Antibody LS‑C334513
CLCN2 antibody LS-C334513 is an unconjugated rabbit polyclonal antibody to CLCN2 from human, mouse and rat. Validated for IHC and WB.
50 µl
100 µl
200 µl

Popular CLCN2 Products

Anti-CLCN2 antibody IHC of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B5141 concentration 3.75 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin
Western Blot analysis of CLCN2 expression in transfected 293T cell line by CLCN2 monoclonal antibody (M01), clone 3E1.Lane 1: CLCN2 transfected lysate(96.8 KDa).Lane 2: Non-transfected lysate.
Species: Human
Applications: Western blot, ELISA, RNA interference
Species: Rat, Human, Mouse, Pig, Rabbit
Applications: IHC, Western blot, ELISA
Species: Human, Mouse, Rat
Applications: IHC, Western blot

Product Description

CLCN2 antibody LS-C334513 is an unconjugated rabbit polyclonal antibody to CLCN2 from human, mouse and rat. Validated for IHC and WB.
About CLCN2
Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport. P51788 NM_004366 NP_004357.3

CLCN2 Antibody, Chloride channel protein 2 Antibody, Chloride channel 2 Antibody, ClC-2 Antibody, CIC-2 Antibody, CLC2 Antibody, EGI3 Antibody, EJM6 Antibody, ECA2 Antibody, ECA3 Antibody, EGMA Antibody, EJM8 Antibody, EGI11 Antibody


Human CLCN2
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
CLCN2 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human CLCN2 (NP_004357.3). RTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHGLPREGSPSDSDDKCQ
Human CLCN2
The predicted MW is 14kDa/93kDa/95kDa/96kDa/98kDa, while the observed MW by Western blot was 98kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 9/25/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy