Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CLCN2 Antibody LS-C334513

CLCN2 antibody LS-C334513 is an unconjugated rabbit polyclonal antibody to CLCN2 from human, mouse and rat. Validated for IHC and WB.
50 µl
100 µl
200 µl
CLCN2 antibody LS-C334513 is an unconjugated rabbit polyclonal antibody to CLCN2 from human, mouse and rat. Validated for IHC and WB.
Human CLCN2
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
CLCN2 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human CLCN2 (NP_004357.3). RTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHGLPREGSPSDSDDKCQ
Human CLCN2
The predicted MW is 14kDa/93kDa/95kDa/96kDa/98kDa, while the observed MW by Western blot was 98kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CLCN2
P51788 NM_004366 NP_004357.3

Popular CLCN2 Products

Anti-CLCN2 antibody IHC of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 3.75 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin
Western Blot analysis of CLCN2 expression in transfected 293T cell line by CLCN2 monoclonal antibody (M01), clone 3E1.Lane 1: CLCN2 transfected lysate(96.8 KDa).Lane 2: Non-transfected lysate.
Species: Human
Applications: Western blot, ELISA, RNA interference
Species: Rat, Human, Mouse, Pig, Rabbit
Applications: IHC, Western blot, ELISA
Species: Human, Mouse, Rat
Applications: IHC, Western blot

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 3/22/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy